PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K02192.1.p
Common NameEUGRSUZ_K02192, LOC104427638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LFY
Protein Properties Length: 360aa    MW: 40980.2 Da    PI: 7.7467
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K02192.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY565.91.1e-1721233646385
           FLO_LFY  46 rklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedee 138
                       r++ +leelf+ayG+rylt+++iae+Gft++tL+dmk+eeldd+m+sls+ifr+dllvGeryGikaa+raerrrl e++   +r++l s+d +
  Eucgr.K02192.1.p  12 RTMGGLEELFEAYGIRYLTASRIAEMGFTANTLLDMKEEELDDMMNSLSHIFRWDLLVGERYGIKAAIRAERRRLLEAD--DRRHHLHSTD-H 101
                       55789***********************************************************************988..6666666666.5 PP

           FLO_LFY 139 taldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqreh 231
                       + ldals++glsee+v ++ e+ + g++g+g+++ +   +   ++++kk+    ++r++ + +k +     +ee++edee+   +++ rqreh
  Eucgr.K02192.1.p 102 ALLDALSHKGLSEEQVMQHSEKDQLGRAGSGDTAGTSWGA---QQQRKKH----RHRHRITAMKGA----ATEEDEEDEEE--VEEMRRQREH 181
                       68**************997777776666644444443331...1222222....222222222111....11222222222..33468***** PP

           FLO_LFY 232 PfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrr 324
                       PfivtepgevargkknGLDYLf+Ly+qCr+fLlqvq++akerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLde+asnalr+
  Eucgr.K02192.1.p 182 PFIVTEPGEVARGKKNGLDYLFHLYDQCRDFLLQVQSLAKERGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEHASNALRK 274
                       ********************************************************************************************* PP

           FLO_LFY 325 afkergenvGawrqacykplvaia.arqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                       +fkergenvGawrqacy+plv+ia +r gwdida+fnahprL iWYvPtkLrqLCh++r+++
  Eucgr.K02192.1.p 275 SFKERGENVGAWRQACYHPLVTIAgRRAGWDIDAIFNAHPRLCIWYVPTKLRQLCHAHRHSS 336
                       ***********************944679******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.4E-1709336IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MDPEAFAVVG LRTMGGLEEL FEAYGIRYLT ASRIAEMGFT ANTLLDMKEE ELDDMMNSLS  60
HIFRWDLLVG ERYGIKAAIR AERRRLLEAD DRRHHLHSTD HALLDALSHK GLSEEQVMQH  120
SEKDQLGRAG SGDTAGTSWG AQQQRKKHRH RHRITAMKGA ATEEDEEDEE EVEEMRRQRE  180
HPFIVTEPGE VARGKKNGLD YLFHLYDQCR DFLLQVQSLA KERGEKCPTK VTNQVFRYAK  240
KAGASYINKP KMRHYVHCYA LHCLDEHASN ALRKSFKERG ENVGAWRQAC YHPLVTIAGR  300
RAGWDIDAIF NAHPRLCIWY VPTKLRQLCH AHRHSSASAA SSASTSTSAP TAHHLELPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1031773495183PROTEIN LEAFY
2vy2_A1e-1031773495183PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K02192.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4539930.0HQ453993.1 Eucalyptus globulus genotype late flowering leafy-like protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010039002.10.0PREDICTED: leafy/floricaula homolog FL1
SwissprotO649530.0FL1_EUCGL; Leafy/floricaula homolog FL1
TrEMBLA0A059A3350.0A0A059A335_EUCGR; Uncharacterized protein
STRINGPOPTR_0015s11820.11e-161(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-136floral meristem identity control protein LEAFY (LFY)